Gene detail [Fasta]
| Species | Apis florea |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003698326.1 |
| sequence |
PEP: >XP_003698326.1 MAVRFVNNNAGVVLAMCRTVLLVFIAVLVLANADQNQSGLKVEKLYVPEVCDAKSKIGDQLTMHYTGTLVDGTKFDSSLD |
| Swiss-Prot | FK506-binding protein 2 |
| KEGG | K09577 |
| SUPERFAMILY | SSF54534 FKBP-like superfamily |
| Gene3D | G3DSA:3.10.50.40 |
| Pfam | PF13499 EF-hand_7; EF-hand domain pair |
| SMART | SM00054 |
| ProSiteProfiles | PS50059 FKBP_PPIASE; FKBP-type peptidyl-prolyl cis-trans isomerase domain profile. |
| ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
| PANTHER | PTHR10516 |
You might be interested in these researchers
You might be interested in these references
