Gene detail [Fasta]
| Species | Apis florea |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012349675.1 |
| sequence |
PEP: >XP_012349675.1 MGKKIIGFSAENKLNKTKDDSWTKHLTTGDLVKFGMIPEFVGRIPIITTLDKLNQKDLVRILTEPKNALVKQYKKLLSLD |
| Swiss-Prot | Probable GTP-binding protein EngB |
| KEGG | K03978 |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:1.10.8.60 |
| Pfam | PF01926 MMR_HSR1; 50S ribosome-binding GTPase |
| SMART | SM01086 |
| ProSiteProfiles | PS51706 G_ENGB; EngB-type guanine nucleotide-binding (G) domain profile. |
| TIGRFAM | TIGR00231 |
| Hamap | MF_00321 |
| PANTHER | PTHR11262 |
You might be interested in these researchers
You might be interested in these references
