Gene detail [Fasta]
| Species | Apis florea |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012349817.1 |
| sequence |
PEP: >XP_012349817.1 SLVMLVTGILIAKGYVTFGVFFSIGNFASTIFTNLVVVANQLTLLHSSQGVDDDLKEQFKRDKLMTTKVTQNEKDEFEQI |
| Swiss-Prot | Lactococcin transport/processing ATP-binding protein LcnC-like |
| KEGG | K06148 ABCC-BAC; ATP-binding cassette, subfamily C, bacterial |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF00005 ABC_tran; ABC transporter |
| SMART | SM00382 |
| ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
| ProSitePatterns | PS00675 SIGMA54_INTERACT_1; Sigma-54 interaction domain ATP-binding region A signature. |
| PANTHER | PTHR24221 |
You might be interested in these researchers
You might be interested in these references
