Gene detail [Fasta]
| Species | Bombus terrestris |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012165882.1 |
| sequence |
PEP: >XP_012165882.1 MEDEEKKCHDEEPSEFYFESDHLALKGNKDYTTLLKTIVILEAQRVQAIEDLDKLLSIRSKALKDPISFVAQIQNDELPE |
| Swiss-Prot | ZZ-type zinc finger-containing protein 3 |
| SUPERFAMILY | SSF57850 RING/U-box superfamily |
| Gene3D | G3DSA:1.10.10.60 |
| Pfam | PF00569 ZZ; Zinc finger, ZZ type |
| SMART | SM00717 |
| ProSiteProfiles | PS51294 HTH_MYB; Myb-type HTH DNA-binding domain profile. |
| ProSitePatterns | PS01357 ZF_ZZ_1; Zinc finger ZZ-type signature. |
| PANTHER | PTHR22705 |
You might be interested in these researchers
You might be interested in these references
