Gene detail [Fasta]
| Species | Bombus impatiens |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012237377.1 |
| sequence |
PEP: >XP_012237377.1 MEDEEKKCHDEEPSEFYFESDHLALKGNKDYTTLLKTIVILEAQRVQAIEDLDKLLSIRSKALKDPISFVAQIQNGELPE |
| Swiss-Prot | ZZ-type zinc finger-containing protein 3 |
| SUPERFAMILY | SSF46689 Homeodomain-like superfamily |
| Gene3D | G3DSA:1.10.10.60 |
| Pfam | PF00249 Myb_DNA-binding; Myb-like DNA-binding domain |
| SMART | SM00717 |
| ProSiteProfiles | PS50135 ZF_ZZ_2; Zinc finger ZZ-type profile. |
| ProSitePatterns | PS01357 ZF_ZZ_1; Zinc finger ZZ-type signature. |
| PANTHER | PTHR22705:SF0 |
You might be interested in these researchers
You might be interested in these references
