Gene detail [Fasta]
| Species | Anopheles sinensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KFB39528.1 |
| sequence |
PEP: >KFB39528.1 MSGVNVSRNEVVQFVLRISLLSIVTYYSAKWLIRNLDPSNKTKKKAIEHAEDILKKLSPTLKKSAVQNLNEYEMVIASHL |
| Swiss-Prot | ATPase family AAA domain-containing protein 1-A |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF00004 AAA; ATPase family associated with various cellular activities (AAA) |
| SMART | SM00382 |
| ProSitePatterns | PS00674 AAA; AAA-protein family signature. |
| PANTHER | PTHR23074:SF20 |
You might be interested in these researchers
You might be interested in these references
