Gene detail [Fasta]
| Species | Drosophila mojavensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002005974.1 |
| sequence |
PEP: >XP_002005974.1 MPPKKAPGPSKKTEQKKKEKVIEDKTFGLKNKKGTKQQKFIQQVQKQVQAGGHHPRQDGDKKKEDKEKKLAEQRELAMIF |
| Swiss-Prot | Zinc finger CCCH domain-containing protein 15 homolog |
| SUPERFAMILY | SSF90229 CCCH zinc finger superfamily |
| Gene3D | G3DSA:4.10.1000.10 |
| Pfam | PF00642 zf-CCCH; Zinc finger C-x8-C-x5-C-x3-H type (and similar) |
| SMART | SM00356 |
| ProSiteProfiles | PS50103 ZF_C3H1; Zinc finger C3H1-type profile. |
| Coils | Coil |
| ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
You might be interested in these researchers
You might be interested in these references
