Gene detail [Fasta]
| Species | Apis dorsata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006612707.1 |
| sequence |
PEP: >XP_006612707.1 MEPPLHAEIRCPGHSSGAMDYPVGARCHIQCRRGFRLEGPHTRYCMAGDQWNGKEPTCIQASIVTDSRYHSDMPRPFVRC |
| Swiss-Prot | Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 |
| SUPERFAMILY | SSF57535 Complement control module/SCR domain superfamily |
| Gene3D | G3DSA:2.10.70.10 |
| Pfam | PF02494 HYR; HYR domain |
| SMART | SM00032 |
| ProSiteProfiles | PS50923 SUSHI; Sushi/CCP/SCR domain profile. |
| PANTHER | PTHR24273:SF29 |
You might be interested in these researchers
You might be interested in these references
