Gene detail [Fasta]
| Species | Apis dorsata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006619226.1 |
| sequence |
PEP: >XP_006619226.1 LATISSSVAGSAGGCGPVVGLPSYKKRQGSGAAWGRGSRGRGRGRGGGASLLGSGVAPANYNSGLQGVAPELREVVNILG |
| Swiss-Prot | Kv channel-interacting protein 4 |
| SUPERFAMILY | SSF47473 EF-hand superfamily |
| Gene3D | G3DSA:1.10.238.10 |
| Pfam | PF13202 EF-hand_5; EF hand |
| SMART | SM00054 |
| ProSiteProfiles | PS50222 EF_HAND_2; EF-hand calcium-binding domain profile. |
| PRINTS | PR00450 |
| Coils | Coil |
| ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
| PANTHER | PTHR23055 |
You might be interested in these researchers
You might be interested in these references
