Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004528492.1 |
| sequence |
PEP: >XP_004528492.1 MALVIENLYKTFEGYAALDRINLTVDKAEFVCLLGPSGCGKTTLLRIIAGLLAADGGKISLDGRDLVNVPARDRGFGIVF |
| Swiss-Prot | Sulfate/thiosulfate import ATP-binding protein CysA 2 |
| KEGG | K02045 cysA; sulfate transport system ATP-binding protein [EC:3.6.3.25] |
| SUPERFAMILY | SSF50331 MOP-like superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF08402 TOBE_2; TOBE domain |
| SMART | SM00382 |
| ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
| ProSitePatterns | PS00211 ABC_TRANSPORTER_1; ABC transporters family signature. |
| PANTHER | PTHR24220:SF318 |
You might be interested in these researchers
You might be interested in these references
