Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004532899.1 |
| sequence |
PEP: >XP_004532899.1 MASVQLRDVTKAWGDVVVSKNINLDIGDGEFVVFVGPSGCGKSTLLRMIAGLETITRGELLIGGKRMNDTPPAERGIGMV |
| Swiss-Prot | Maltose/maltodextrin import ATP-binding protein MalK |
| KEGG | K10111 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:3.6.3.-] |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:2.40.50.140 |
| Pfam | PF08402 TOBE_2; TOBE domain |
| SMART | SM00382 |
| ProSiteProfiles | PS51245 MALK; Maltose/Maltodextrin import ATP-binding protein malK family profile. |
| ProSitePatterns | PS00211 ABC_TRANSPORTER_1; ABC transporters family signature. |
| PANTHER | PTHR24220:SF319 |
You might be interested in these researchers
You might be interested in these references
