Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012162076.1 |
| sequence |
PEP: >XP_012162076.1 MGTGHYFWAIFYFASLCSASLANNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTENAPTLVYVNMFLRSISKIDDY |
| Swiss-Prot | Glutamate-gated chloride channel |
| KEGG | K05273 |
| SUPERFAMILY | SSF90112 Neurotransmitter-gated ion-channel transmembrane pore superfamily |
| Gene3D | G3DSA:1.20.58.390 |
| Pfam | PF02931 Neur_chan_LBD; Neurotransmitter-gated ion-channel ligand binding domain |
| PRINTS | PR00252 |
| Coils | Coil |
| ProSitePatterns | PS00236 NEUROTR_ION_CHANNEL; Neurotransmitter-gated ion-channels signature. |
| TIGRFAM | TIGR00860 |
| PANTHER | PTHR18945 |
You might be interested in these researchers
You might be interested in these references
