Gene detail [Fasta]
| Species | Cerapachys biroi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011335938.1 |
| sequence |
PEP: >XP_011335938.1 MDSDQQQQFCLKWNSFGNNLATSFSNLFKSESLTDVTLFCEGVTFRAHRLILAACSKHFQELFEGMPPSPAGLIVILDGT |
| Swiss-Prot | Longitudinals lacking protein-like |
| SUPERFAMILY | SSF54695 POZ domain superfamily |
| Gene3D | G3DSA:3.30.710.10 |
| Pfam | PF00651 BTB; BTB/POZ domain |
| SMART | SM00225 |
| ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
| ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
| PANTHER | PTHR23110 |
You might be interested in these researchers
You might be interested in these references
