Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Drosophila erecta
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_001977182.1
sequence PEP:
>XP_001977182.1
MSLLLLLLAVVLPQPQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLGDCCDDFKDHCG
GKCY
Swiss-ProtSomatomedin-B and thrombospondin type-1 domain-containing protein
SUPERFAMILYSSF90188  Somatomedin B domain superfamily     
PfamPF01033  Somatomedin_B; Somatomedin B domain     
ProSiteProfilesPS50958  SMB_2; Somatomedin B (SMB) domain profile.     
ProSitePatternsPS00524  SMB_1; Somatomedin B domain (SMB) signature.     

You might be interested in these researchers

You might be interested in these references