Gene detail [Fasta]
| Species | Diaphorina citri |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008482373.1 |
| sequence |
PEP: >XP_008482373.1 MADGGVWKLQDDGYLNIDADPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTD |
| Swiss-Prot | Baculoviral IAP repeat-containing protein 6 |
| KEGG | K10586 BIRC6, BRUCE; baculoviral IAP repeat-containing protein 6 (apollon) [EC:6.3.2.19] |
| SUPERFAMILY | SSF57924 Inhibitor of apoptosis (IAP) repeat superfamily |
| Gene3D | G3DSA:1.10.1170.10 |
| Pfam | PF00653 BIR; Inhibitor of Apoptosis domain |
| ProSiteProfiles | PS50143 BIR_REPEAT_2; BIR repeat profile. |
You might be interested in these researchers
You might be interested in these references
