Gene detail [Fasta]
| Species | Drosophila pseudoobscura |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001359207.1 |
| sequence |
PEP: >XP_001359207.1 MATIRSRLHTPETKADSQQITNNNNDGKQHGKEATKNAEPKEKSDPMIYIIFVSLLFDLLAFTIILPLLPSLLEYYRVND |
| Swiss-Prot | Major facilitator superfamily domain-containing protein 10 |
| SUPERFAMILY | SSF103473 MFS general substrate transporter superfamily |
| Gene3D | G3DSA:1.20.1250.20 |
| Pfam | PF07690 MFS_1; Major Facilitator Superfamily |
| ProSiteProfiles | PS50850 MFS; Major facilitator superfamily (MFS) profile. |
| ProSitePatterns | PS00216 SUGAR_TRANSPORT_1; Sugar transport proteins signature 1. |
| PANTHER | PTHR24003:SF462 |
You might be interested in these researchers
You might be interested in these references
