Gene detail [Fasta]
| Species | Drosophila persimilis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002014065.1 |
| sequence |
PEP: >XP_002014065.1 MVPRWYKRFFSLSLYSRRQDCKASLTHKTELMDKLEDQKEDMASTIEQLEKKWTHDKSNLGEILKTTSQTLTTQVTASEE |
| Swiss-Prot | RUN and FYVE domain-containing protein 2 |
| KEGG | K12478 EEA1; early endosome antigen 1 |
| SUPERFAMILY | SSF57903 FYVE/PHD zinc finger superfamily |
| Gene3D | G3DSA:3.30.40.10 |
| Pfam | PF01363 FYVE; FYVE zinc finger |
| SMART | SM00064 |
| ProSiteProfiles | PS50178 ZF_FYVE; Zinc finger FYVE/FYVE-related type profile. |
| Coils | Coil |
| PANTHER | PTHR22835 |
You might be interested in these researchers
You might be interested in these references
