Gene detail [Fasta]
| Species | Athalia rosae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012263617.1 |
| sequence |
PEP: >XP_012263617.1 MEDSDVKQVESEENESSTEEIADQTDEGNGCAHYKRKSKFVTPCCNKVYTCRFCHDEQEAHTVNRKEVTELICVLCDTRQ |
| Swiss-Prot | RING finger and CHY zinc finger domain-containing protein 1 |
| SUPERFAMILY | SSF161219 CHY zinc finger-like superfamily |
| Gene3D | G3DSA:3.30.40.10 |
| Pfam | PF05495 zf-CHY; CHY zinc finger |
| SMART | SM00184 |
| ProSiteProfiles | PS50089 ZF_RING_2; Zinc finger RING-type profile. |
| ProSitePatterns | PS01359 ZF_PHD_1; Zinc finger PHD-type signature. |
You might be interested in these researchers
You might be interested in these references
