Gene detail [Fasta]
| Species | Fopius arisanus |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011298191.1 |
| sequence |
PEP: >XP_011298191.1 MAHGSQNYGSTDHRTDVPDVGFSPTELYSLSENITTNIYTINTGWKTLERAFKSIGTSKDNQGLRDKVHNTQMSTNQVVT |
| Swiss-Prot | t-SNARE domain-containing protein 1 |
| SUPERFAMILY | SSF47661 t-snare proteins superfamily |
| Gene3D | G3DSA:1.20.5.110 |
| Pfam | PF14523 Syntaxin_2; Syntaxin-like protein |
| SMART | SM00397 |
| ProSiteProfiles | PS50192 T_SNARE; t-SNARE coiled-coil homology domain profile. |
| Coils | Coil |
| ProSitePatterns | PS00914 SYNTAXIN; Syntaxin / epimorphin family signature. |
| PANTHER | PTHR19957:SF38 |
You might be interested in these researchers
You might be interested in these references
