Gene detail [Fasta]
| Species | Megachile rotundata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012137537.1 |
| sequence |
PEP: >XP_012137537.1 MDPSVLANMDKDALKKQIENMKYQASMERWPLSKSIAAMREYVEENEKTDPLIHAPDKKNNPWAEKGKCIIM |
| Swiss-Prot | Guanine nucleotide-binding protein subunit gamma-e |
| KEGG | K04547 GNG13; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 |
| SUPERFAMILY | SSF48670 Transducin (heterotrimeric G protein), gamma chain superfamily |
| Gene3D | G3DSA:4.10.260.10 |
| Pfam | PF00631 G-gamma; GGL domain |
| SMART | SM00224 |
| ProSiteProfiles | PS50058 G_PROTEIN_GAMMA; G-protein gamma subunit domain profile. |
| PRINTS | PR00321 |
| PANTHER | PTHR15936 |
You might be interested in these researchers
You might be interested in these references
