Gene detail [Fasta]
| Species | Megachile rotundata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012138953.1 |
| sequence |
PEP: >XP_012138953.1 MSKMYTTANLSDKELKEQGNRLFNLHKYEDAAYCYTKAIIKNPTQALYFTNRALCNLKLKRWESSCQDCRRALDIDPCLV |
| Swiss-Prot | STIP1 homology and U box-containing protein 1 |
| KEGG | K09561 STUB1, CHIP; STIP1 homology and U-box containing protein 1 [EC:6.3.2.19] |
| SUPERFAMILY | SSF57850 RING/U-box superfamily |
| Gene3D | G3DSA:1.25.40.10 |
| Pfam | PF13414 TPR_11; TPR repeat |
| SMART | SM00504 |
| ProSiteProfiles | PS51698 U_BOX; U-box domain profile. |
| Coils | Coil |
| PANTHER | PTHR22904:SF305 |
You might be interested in these researchers
You might be interested in these references
