Gene detail [Fasta]
| Species | Ceratosolen solmsi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011493897.1 |
| sequence |
PEP: >XP_011493897.1 MEKDKDLGDYSSGGNGNSLEQTDKSNEVVEDNYGCEHYKRKSKFVTPCCNKVYTCRFCHDEQEAHTVKRKEVTELICVLC |
| Swiss-Prot | RING finger and CHY zinc finger domain-containing protein 1 |
| SUPERFAMILY | SSF57850 RING/U-box superfamily |
| Gene3D | G3DSA:3.30.40.10 |
| Pfam | PF13639 zf-RING_2; Ring finger domain |
| SMART | SM00184 |
| ProSiteProfiles | PS51266 ZF_CHY; Zinc finger CHY-type profile. |
| ProSitePatterns | PS01359 ZF_PHD_1; Zinc finger PHD-type signature. |
| PANTHER | PTHR21319 |
You might be interested in these researchers
You might be interested in these references
