Gene detail [Fasta]
| Species | Ceratosolen solmsi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011504031.1 |
| sequence |
PEP: >XP_011504031.1 MNDKKELLHLRDIGFRTGENIILLHVGFSLSPGEFKLITGPSGCGKSTLLKIVASLLSPTEGTLLFEGQDIASLSPESYR |
| Swiss-Prot | Probable iron export ATP-binding protein FetA |
| KEGG | K02068 |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF03649 UPF0014; Uncharacterised protein family (UPF0014) |
| SMART | SM00382 |
| ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
| ProSitePatterns | PS00211 ABC_TRANSPORTER_1; ABC transporters family signature. |
| PANTHER | PTHR24220:SF410 |
You might be interested in these researchers
You might be interested in these references
