Gene detail [Fasta]
| Species | Drosophila yakuba |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002101125.1 |
| sequence |
PEP: >XP_002101125.1 MPSRRRKNSKVSTSNAVDNREYLVEKIVGKRFRDGRPQFLVKWQGFPEEVNSWEPLEGVGHLYYLLADFEAEEYKRSQEK |
| Swiss-Prot | Chromo domain-containing protein LHP1 |
| SUPERFAMILY | SSF54160 Chromo domain-like superfamily |
| Gene3D | G3DSA:2.40.50.40 |
| Pfam | PF00385 Chromo; Chromo (CHRromatin Organisation MOdifier) domain |
| SMART | SM00298 |
| ProSiteProfiles | PS50013 CHROMO_2; Chromo and chromo shadow domain profile. |
| ProSitePatterns | PS00598 CHROMO_1; Chromo domain signature. |
| PANTHER | PTHR22812 |
You might be interested in these researchers
You might be interested in these references
